SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|140161500|ref|NP_056060.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|140161500|ref|NP_056060.2|
Domain Number 1 Region: 8-33,69-290
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.11e-62
Family Ankyrin repeat 0.0000363
Further Details:      
 
Domain Number 2 Region: 904-1066
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-45
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 3 Region: 698-762
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-16
Family SAM (sterile alpha motif) domain 0.0029
Further Details:      
 
Domain Number 4 Region: 768-838
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000143
Family SAM (sterile alpha motif) domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|140161500|ref|NP_056060.2|
Sequence length 1134
Comment ankyrin repeat and SAM domain-containing protein 1A [Homo sapiens]
Sequence
MGKEQELLEAARTGHLPAVEKLLSGKRLSSGFGGGGGGGSGGGGGGSGGGGGGLGSSSHP
LSSLLSMWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADSKGCYPLHLA
AWKGDAQIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKVLLEELTDPTMRNN
KFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGMD
SNYQTEMGSALHEAALFGKTDVVQILLAAGTDVNIKDNHGLTALDTVRELPSQKSQQIAA
LIEDHMTGKRSTKEVDKTPPPQPPLISSMDSISQKSQGDVEKAVTELIIDFDANAEEEGP
YEALYNAISCHSLDSMASGRSSDQDSTNKEAEAAGVKPAGVRPRERPPPPAKPPPDEEEE
DHIDKKYFPLTASEVLSMRPRIHGSAAREEDEHPYELLLTAETKKVVLVDGKTKDHRRSS
SSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLCTAGQSHPDGSPQQGACHKA
SMQLEETGVHAPGASQPSALDQSKRVGYLTGLPTTNSRSHPETLTHTASPHPGGAEEGDR
SGARSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDATMGSRSESLSNCSIGKKRLEK
SPSFASEWDEIEKIMSSIGEGIDFSQERQKISGLRTLEQSVGEWLESIGLQQYESKLLLN
GFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARSLPKVKALGYDGNSPPSVPSWLD
SLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVQLLGHRKRIIASLADRPYEEPPQK
PPRFSQLRCQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGRRRHDSLHDPAAPSRAERF
RIQEEHREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTES
TQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLC
TFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRATGASAAE
MIETKSSKPVPKPRVGVRKSALEPPDMDQDAQSHASVSWVVDPKPDSKRSLSTN
Download sequence
Identical sequences Q92625
ENSP00000353518 NP_056060.2.87134 NP_056060.2.92137 ENSP00000353518 gi|140161500|ref|NP_056060.2| 9606.ENSP00000353518 ENSP00000353518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]