SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14150169|ref|NP_115736.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14150169|ref|NP_115736.1|
Domain Number 1 Region: 160-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-29
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 2 Region: 42-126
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 1.14e-26
Family Acyl-CoA binding protein 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14150169|ref|NP_115736.1|
Sequence length 282
Comment acyl-CoA-binding domain-containing protein 6 [Homo sapiens]
Sequence
MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVA
SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKK
LDPGWNPQIPEKKGKEANTGFGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKS
KNVDVNVKDEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
Download sequence
Identical sequences A0A024R915 H2Q0Q0 Q9BR61
NP_115736.1.87134 NP_115736.1.92137 XP_524985.1.37143 ENSPTRP00000002906 ENSP00000356567 gi|14150169|ref|NP_115736.1| 9598.ENSPTRP00000002906 9606.ENSP00000356567 ENSP00000356567 ENSP00000356567 ENSPTRP00000002906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]