SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14318424|ref|NP_116186.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14318424|ref|NP_116186.1|
Domain Number 1 Region: 14-318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.4e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14318424|ref|NP_116186.1|
Sequence length 373
Comment apoptosis-inducing factor 2 [Homo sapiens]
Sequence
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP
Download sequence
Identical sequences Q9BRQ8
ENSP00000312370 ENSP00000312370 ENSP00000362345 ENSP00000478931 AMID HR6813 NP_001185625.1.87134 NP_001185625.1.92137 NP_116186.1.87134 NP_116186.1.92137 ENSP00000312370 ENSP00000362345 gi|14318424|ref|NP_116186.1| gi|311082415|ref|NP_001185625.1| 9606.ENSP00000312370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]