SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|144953901|ref|NP_060906.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|144953901|ref|NP_060906.3|
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-56
Family Allantoicase repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 188-369
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-48
Family Allantoicase repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|144953901|ref|NP_060906.3|
Sequence length 391
Comment probable allantoicase isoform a [Homo sapiens]
Sequence
MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
FEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
EEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
LRLRGFPSSICLLRPREKPMLKFSVSFKANP
Download sequence
Identical sequences B4DY77
ENSP00000252505 NYSGRC-144953901 9606.ENSP00000252505 NP_060906.3.87134 NP_060906.3.92137 gi|144953901|ref|NP_060906.3| ENSP00000252505 ENSP00000252505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]