SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145312251|ref|NP_001073917.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145312251|ref|NP_001073917.2|
Domain Number 1 Region: 718-792,835-1048
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-80
Family Protein kinases, catalytic subunit 0.00000000248
Further Details:      
 
Domain Number 2 Region: 128-299
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-72
Family Ephrin receptor ligand binding domain 0.00000147
Further Details:      
 
Domain Number 3 Region: 425-629
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-34
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 4 Region: 1053-1125
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.91e-20
Family SAM (sterile alpha motif) domain 0.00034
Further Details:      
 
Domain Number 5 Region: 354-417,463-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000279
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145312251|ref|NP_001073917.2|
Sequence length 1130
Comment ephrin type-A receptor 6 isoform a [Homo sapiens]
Sequence
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEE
EEEDVDKDPHPTQNTCLRCRHFSLRERKREPRRTMGGCEVREFLLQFGFFLPLLTAWPGD
CSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYT
KIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKK
CPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICS
TGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSM
ACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGL
RFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLI
GVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLK
PATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILT
LFFLITGRCQWYIKAKMKSEEKRRNHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEI
DPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQ
FDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRP
VMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILV
NSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVM
WEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDI
VSFLDKLIRNPSALHTLVEDILVMPESPGEVPEYPLFVTVGDWLDSIKMGQYKNNFVAAG
FTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV
Download sequence
Identical sequences A0A0B4J1T8
ENSP00000374323 ENSP00000374323 gi|145312251|ref|NP_001073917.2| ENSP00000403100 NP_001073917.2.87134 NP_001073917.2.92137 9606.ENSP00000374323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]