SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14602457|ref|NP_115781.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14602457|ref|NP_115781.1|
Domain Number 1 Region: 192-324
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.12e-37
Family Eukaryotic proteases 0.0019
Further Details:      
 
Domain Number 2 Region: 104-210
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-18
Family Hepsin, N-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14602457|ref|NP_115781.1|
Sequence length 344
Comment transmembrane protease serine 3 isoform 3 [Homo sapiens]
Sequence
MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALI
LALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVF
TAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDK
VTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYH
LCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKR
LGNDIALMKLAGPLTFNGTSGSLCGSAALPLFQEDLQLLIEAFL
Download sequence
Identical sequences ENSP00000381434 gi|14602457|ref|NP_115781.1| ENSP00000381434 NP_115781.1.87134 NP_115781.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]