SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146232000|ref|NP_001078940.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146232000|ref|NP_001078940.1|
Domain Number 1 Region: 113-203
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-34
Family Forkhead DNA-binding domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146232000|ref|NP_001078940.1|
Sequence length 490
Comment forkhead box protein N3 isoform 1 [Homo sapiens]
Sequence
MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL
TNLNWLHESKNLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFS
CLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERS
QSIGKGSLWCIDPEYRQNLIQALKKTPYHPHPHVFNTPPTCPQAYQSTSGPPIWPGSTFF
KRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGARVLSRGLFPGVRPLPITPIG
VTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSPTSDSISSSSS
SADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKG
QKEQKETTKN
Download sequence
Identical sequences A0A024R6I1 O00409
NP_001078940.1.87134 NP_001078940.1.92137 ENSP00000261302 ENSP00000343288 ENSP00000261302 gi|146232000|ref|NP_001078940.1| 9606.ENSP00000261302 ENSP00000261302 ENSP00000343288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]