SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148539837|ref|NP_001908.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148539837|ref|NP_001908.3|
Domain Number 1 Region: 1-208,272-334
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.29e-32
Family D-aminoacid oxidase, N-terminal domain 0.0000000286
Further Details:      
 
Domain Number 2 Region: 195-287
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.78e-24
Family D-aminoacid oxidase-like 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148539837|ref|NP_001908.3|
Sequence length 347
Comment D-amino-acid oxidase [Homo sapiens]
Sequence
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Download sequence
Identical sequences A0A024RBI1 P14920
2du8_A 2du8_B 2du8_G 2du8_J 2e48_A 2e48_B 2e48_C 2e48_D 2e49_A 2e49_B 2e49_C 2e49_D 2e4a_A 2e4a_B 2e4a_C 2e4a_D 2e82_A 2e82_B 2e82_C 2e82_D 3cuk_A 3cuk_B 3cuk_C 3cuk_D 3w4i_A 3w4i_B 3w4i_C 3w4i_D 3w4j_A 3w4j_B 3w4j_C 3w4j_D 3w4k_A 3w4k_B 3w4k_C 3w4k_D 3znn_A 3znn_B 3zno_A 3zno_B 3znp_A 3znp_B 3znq_A 3znq_B 4qfc_A 4qfc_B 4qfd_A 4qfd_B ENSP00000228476 NP_001908.3.87134 NP_001908.3.92137 XP_011536306.1.92137 XP_011536307.1.92137 gi|148539837|ref|NP_001908.3| 9606.ENSP00000228476 ENSP00000228476 ENSP00000228476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]