SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148596917|ref|NP_660278.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148596917|ref|NP_660278.3|
Domain Number 1 Region: 105-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.56e-60
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000649
Family Fibronectin type III 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148596917|ref|NP_660278.3|
Sequence length 345
Comment fibronectin type 3 and ankyrin repeat domains protein 1 [Homo sapiens]
Sequence
MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYG
IIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSV
NDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDS
LMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVD
TGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDK
GADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC
Download sequence
Identical sequences Q8TC84
ENSP00000357682 9606.ENSP00000357682 ENSP00000357682 gi|148596917|ref|NP_660278.3| NP_660278.3.87134 NP_660278.3.92137 ENSP00000411388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]