SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148612795|ref|NP_055668.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148612795|ref|NP_055668.2|
Domain Number 1 Region: 587-650,825-944
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0077
Further Details:      
 
Domain Number 2 Region: 8-96,123-200
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-33
Family RUN domain 0.0015
Further Details:      
 
Domain Number 3 Region: 920-1043
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148612795|ref|NP_055668.2|
Sequence length 1051
Comment small G protein signaling modulator 2 isoform 1 [Homo sapiens]
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAP
ALSPQALKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPAKRPALGIRKRHSSGSASEDRLA
ACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI
IYPGHRHEHITINYHHLAASRAASVDDDEEEEDKLHAMLSMICSRNLTAPNPMKDAGDMI
EMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPDRLPLRLLCESMKRQI
VSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTKDVWSKYQKDKKNYKE
LELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVAARYQQVLAEWKACEV
VVRQREREAHPATRTKFSSGSSIDSHVQRLIHRDSTISNDVFISVDDLEPPEPQDPEDSR
PKPEQEAGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVASGIQSSLDEGQSVGFEEED
GGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLH
RIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMCDLLAPLLVTLDNDQL
AYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWF
LLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKF
FNERAEHHDAQEILRIARDLVHKVQMLIENK
Download sequence
Identical sequences ENSP00000415107 ENSP00000268989 gi|148612795|ref|NP_055668.2| 9606.ENSP00000268989 NP_055668.2.87134 NP_055668.2.92137 ENSP00000268989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]