SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148613884|ref|NP_004813.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148613884|ref|NP_004813.2|
Domain Number 1 Region: 468-601
Classification Level Classification E-value
Superfamily TIMP-like 1.63e-37
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 341-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 95-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000118
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  gi|148613884|ref|NP_004813.2|
Domain Number - Region: 155-226
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0706
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148613884|ref|NP_004813.2|
Sequence length 604
Comment netrin-1 precursor [Homo sapiens]
Sequence
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA
Download sequence
Identical sequences A0A2J8TFB5 A0A2K6EX63 H2QC90 O95631
ENSP00000173229 gi|148613884|ref|NP_004813.2| 9606.ENSP00000173229 ENSP00000173229 NYSGRC-148613884 ENSP00000173229 ENSP00000441611 ENSP00000443259 NP_004813.2.87134 NP_004813.2.92137 XP_004433126.1.5094 XP_006721658.1.92137 XP_012511091.1.63892 XP_016010155.1.101085 XP_016010157.1.101085 XP_016787898.1.37143 XP_016787899.1.37143 XP_016787900.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]