SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148664242|ref|NP_620481.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148664242|ref|NP_620481.2|
Domain Number 1 Region: 13-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 651-677,712-865
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-38
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 280-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-34
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 4 Region: 896-1100
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-30
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 5 Region: 128-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-25
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 507-564
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000553
Family Fibrinogen C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 7 Region: 478-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148664242|ref|NP_620481.2|
Sequence length 1235
Comment contactin-associated protein-like 4 isoform 2 [Homo sapiens]
Sequence
MWNYDCDDPLVSALPQASFSSSSELSSSHGPGFARLNRRDGAGGWSPLVSNKYQWLQIDL
GERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNWKQYRQEDSIWGFSGNANADSVVYYR
LQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYRSEVVDLDGKSSLLYRFDQKSLSPIK
DIISLKFKTMQSDGILLHREGPNGDHITLQLRRARLFLLINSGEAKLPSTSTLVNLTLGS
LLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGEFNLMNLDYEGNVSFSCSQPQSMPVT
FLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGILLFLSDGKLKSNLY
QPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLLGPEQIYSGGTYYF
GGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFSDLQIDSCGISDRC
LPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHRGNTSGFYYIDSDG
SGPLEPFLLYCNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATINRA
EHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNETQTYWGGSSPDLQKCTCGLEGNCIDS
QYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTGRLHSEAAYKLGPLLCQGDRSFWN
SASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFIRIELRSPTVVTFS
FDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQPAPADGHVLLQLN
SQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRGHCSSYGKLCRNGG
KCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLLSKNSSSHAASFHG
DMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSVIIAKNGSLQIRYKLNKYQEPDVVNF
DFKNMADGQLHHIMINREEGVVFIEIDDNRRRQVHLSSGTEFSAVKSLVLGRILEHSDVD
QDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSR
ERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAIAVRIYQQKRLYKR
SEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF
Download sequence
Identical sequences NP_620481.2.87134 NP_620481.2.92137 gi|148664242|ref|NP_620481.2| ENSP00000418741 ENSP00000418741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]