SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148806877|ref|NP_597704.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148806877|ref|NP_597704.1|
Domain Number 1 Region: 331-443
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0005
Further Details:      
 
Domain Number 2 Region: 122-183,271-316
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-19
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 
Domain Number 3 Region: 455-545
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-16
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148806877|ref|NP_597704.1|
Sequence length 550
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 [Homo sapiens]
Sequence
MTIISVTLEIHHHITERDADRSLTILDEQLYSFAFSTVHITKKRNGGGSLNNYSSSIPLT
PSTSQEDLYFSVPPTANTPTPICKQSMGWSNLFTSEKGSDPDKGRKALESHADTIGSGRA
IPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVP
GKWPSLATSACAPISSSKSNGLSKDMEALHMSANSDIGLGDSICFSPSISSTTSPKLNLP
PSPHANKKKHLKKKSTNNLKDDGLSSTAEEEEEKFMIVSVTGQTCHFKATTYEERDAWVQ
AIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNSHCVDCETQNPKWASLNLGV
LMCIECSGIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSI
ESTREEKERWIRSKYEHKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSREEVN
ETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVL
LQYGCPDECV
Download sequence
Identical sequences Q8TF27
NP_597704.1.87134 NP_597704.1.92137 gi|148806877|ref|NP_597704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]