SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14916473|ref|NP_149119.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14916473|ref|NP_149119.1|
Domain Number 1 Region: 130-268
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.2e-35
Family Gelsolin-like 0.00000886
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 8.89e-34
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 3 Region: 363-467
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.03e-32
Family Gelsolin-like 0.00000783
Further Details:      
 
Domain Number 4 Region: 261-354
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.95e-22
Family Gelsolin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14916473|ref|NP_149119.1|
Sequence length 468
Comment adseverin isoform 2 [Homo sapiens]
Sequence
MAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKDANPQERK
AAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVYVTEKVAQ
IKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFYGGDCYII
LYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFK
DKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQ
NSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLET
QAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEK
KESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
Download sequence
Identical sequences gi|14916473|ref|NP_149119.1| ENSP00000430997 ENSP00000390189 ENSP00000430997 NP_149119.1.87134 NP_149119.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]