SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150010661|ref|NP_055507.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150010661|ref|NP_055507.1|
Domain Number 1 Region: 304-501
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.49e-46
Family CRAL/TRIO domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 220-303
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.49e-21
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 509-667
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.32e-19
Family Supernatant protein factor (SPF), C-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150010661|ref|NP_055507.1|
Sequence length 696
Comment SEC14-like protein 5 [Homo sapiens]
Sequence
MVQRYQSPVRVYKYPFELVMAAYEKRFPTCPQIPVFLGSEVLRESRSPDGAVHVVERSCR
LRVDAPRLLRKIAGVEHVVFVQTNILNWKERTLLIEAHNETFANRVVVNEHCSYTVHPEN
EDWTCFEQSASLDIRSFFGFENALEKIAMKQYTANVKRGKEVIEHYLNELISQGTSHIPR
WTPAPVREEDARNQAGPRDPSSLEAHGPRSTLGPALEAVSMDGDKLDADYIERCLGHLTP
MQESCLIQLRHWLQETHKGKIPKDEHILRFLRAHDFHLDKAREMLRQSLSWRKQHQVDLL
LQTWQPPALLEEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEE
GQKRCEGSTRQLGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLL
IVRAPRVFPVLWTLISPFINENTRRKFLIYSGSNYQGPGGLVDYLDREVIPDFLGGESVC
NVPEGGLVPKSLYMTEEEQEHTDQLWQWSETYHSASVLRGAPHEVAVEILEGESVITWDF
DILRGDVVFSLYHTKQAPRLGAREPGTRASGQLIDKGWVLGRDYSRVEAPLVCREGESIQ
GSHVTRWPGVYLLQWQMHSPPSSVACSLPGVDDVLTALHSPGPKCKLLYYCEVLASEDFR
GSMSSLESCTSGFSQLSAATSSSSSGQSHSSSLVSR
Download sequence
Identical sequences O43304
9606.ENSP00000251170 NP_055507.1.87134 NP_055507.1.92137 ENSP00000251170 ENSP00000251170 gi|150010661|ref|NP_055507.1| ENSP00000251170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]