SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150170658|ref|NP_660312.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150170658|ref|NP_660312.2|
Domain Number 1 Region: 9-208
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000227
Family FCH domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150170658|ref|NP_660312.2|
Sequence length 289
Comment hypothetical protein LOC137392 [Homo sapiens]
Sequence
MMRRTLENRNAQTKQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAA
TETPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTAR
NREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDI
KTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRAN
SKSPLQRSLSAKCVSGTGQVSTCRLRKDQQAEDDEDDELDVTEEENFLK
Download sequence
Identical sequences A1XBS5
NP_660312.2.87134 NP_660312.2.92137 ENSP00000429367 ENSP00000429367 9606.ENSP00000391671 ENSP00000391671 gi|150170658|ref|NP_660312.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]