SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150170706|ref|NP_055700.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150170706|ref|NP_055700.2|
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-52
Family APC10-like 0.0000000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150170706|ref|NP_055700.2|
Sequence length 185
Comment anaphase-promoting complex subunit 10 [Homo sapiens]
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences A0A096N869 A0A0D9S171 A0A1S3A2H7 A0A1U7ULX5 A0A250XVU7 A0A287AJ72 A0A2I3RW15 A0A2J8XNX9 A0A2K5EGA5 A0A2K5HAH2 A0A2K5N2A3 A0A2K5Q3K3 A0A2K5U8L7 A0A2K6A2H8 A0A2K6C1G3 A0A2K6FKZ6 A0A2K6NM97 A0A2K6TVH7 D2H3Q0 E2R745 F2Z4G9 F6X9H3 F6YKG3 F7GPG7 G1PBT8 G1R082 G3S5D3 G3T394 G5C7E6 H0WV60 I3MAA7 L5MCR1 L8HSD1 M3WVJ2 M3Y5H6 Q9UM13 W5PJN1
ENSLAFP00000007691 ENSMPUP00000006577 ENSP00000310071 ENSP00000403891 ENSP00000423995 ENSCJAP00000004831 ENSLAFP00000007691 ENSGGOP00000023289 ENSCAFP00000011229 ENSPTRP00000028292 ENSNLEP00000006603 ENSPANP00000008794 ENSDNOP00000022417 ENSAMEP00000017523 ENSNLEP00000006603 gi|150170706|ref|NP_055700.2| ENSP00000310071 ENSMLUP00000007846 ENSPVAP00000012420 ENSOGAP00000006179 ENSMPUP00000006577 ENSPVAP00000012420 ENSECAP00000021879 ENSECAP00000021879 5a31_L 5g05_L 5khr_L 5l9t_L 5l9u_L 5lcw_L ENSMMUP00000005911 HGL_H00000310071-2 9544.ENSMMUP00000005911 9598.ENSPTRP00000028292 9606.ENSP00000310071 9615.ENSCAFP00000011229 9796.ENSECAP00000021879 9913.ENSBTAP00000017721 ENSPTRP00000028292 ENSMMUP00000005911 ENSOGAP00000006179 ENSAMEP00000017523 ENSSSCP00000009649 ENSMLUP00000007846 ENSBTAP00000017721 ENSSSCP00000009649 ENSBTAP00000017721 ENSCJAP00000004831 ENSCJAP00000004833 ENSP00000310071 ENSP00000403891 ENSP00000423995 ENSP00000478501 NP_001243635.1.87134 NP_001243635.1.92137 NP_001243636.1.87134 NP_001243636.1.92137 NP_001243637.1.87134 NP_001243637.1.92137 NP_055700.2.87134 NP_055700.2.92137 XP_002745363.2.60252 XP_002916280.1.58354 XP_003257813.1.23891 XP_003257816.1.23891 XP_003417548.1.64505 XP_003790240.1.62490 XP_003985025.1.62641 XP_004017272.1.66739 XP_004263651.1.21590 XP_004263652.1.21590 XP_004316567.1.83887 XP_004378911.1.4749 XP_004411824.1.74151 XP_004420937.1.5094 XP_004456572.1.11602 XP_004456573.1.11602 XP_004588194.1.84141 XP_004655906.1.11716 XP_004685358.1.23501 XP_004758050.1.14098 XP_004758051.1.14098 XP_005217570.1.76553 XP_005386694.1.28644 XP_005386695.1.28644 XP_005556060.1.63531 XP_005607883.1.31192 XP_005607884.1.31192 XP_005629366.1.84170 XP_006062191.1.26621 XP_006062194.1.26621 XP_006081800.1.53796 XP_006169556.1.99106 XP_006169557.1.99106 XP_006187277.1.101512 XP_006209981.1.17985 XP_006744160.1.47382 XP_006756021.1.95426 XP_007091834.1.5354 XP_007127463.1.24612 XP_007127464.1.24612 XP_007466963.1.90284 XP_007528339.1.11023 XP_007998091.1.81039 XP_008069708.1.4292 XP_008683661.1.72690 XP_008967106.1.60992 XP_008967107.1.60992 XP_008990893.1.60252 XP_009446641.1.37143 XP_009446642.1.37143 XP_010336935.1.74449 XP_010359552.1.97406 XP_010812027.1.76553 XP_010837426.1.44457 XP_010952893.1.22495 XP_010980967.1.51371 XP_011357727.1.92234 XP_011357728.1.92234 XP_011357729.1.92234 XP_011529826.1.92137 XP_011708766.1.29376 XP_011812395.1.43180 XP_011812402.1.43180 XP_011842534.1.47321 XP_011842535.1.47321 XP_011842536.1.47321 XP_011904563.1.92194 XP_011952812.1.66739 XP_012024893.1.54773 XP_012024894.1.54773 XP_012309416.1.9421 XP_012363622.1.23891 XP_012498190.1.63892 XP_012498191.1.63892 XP_012639252.1.48125 XP_012783292.1.84141 XP_013215131.1.77405 XP_013975015.1.84170 XP_013975016.1.84170 XP_014693600.1.49734 XP_014937444.1.86478 XP_014994784.1.72884 XP_015339930.1.40921 XP_016019518.1.101085 XP_016019528.1.101085 XP_016062406.1.3490 XP_016062407.1.3490 XP_016062408.1.3490 XP_017390076.1.71028 XP_017390084.1.71028 XP_017501175.1.32401 XP_017737020.1.44346 XP_017917061.1.57651 XP_018880972.1.27298 XP_018880973.1.27298 XP_019276144.1.44245 XP_019517596.1.44202 XP_019586323.1.88060 XP_019586328.1.88060 XP_020022863.1.5219 XP_021534992.1.83697 XP_532678.1.84170 ENSGGOP00000023289 ENSOARP00000010652 ENSCAFP00000011229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]