SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150378537|ref|NP_001092877.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378537|ref|NP_001092877.1|
Domain Number 1 Region: 619-724
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|150378537|ref|NP_001092877.1|
Domain Number - Region: 265-310,339-386
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0837
Family Cytochrome c3-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378537|ref|NP_001092877.1|
Sequence length 752
Comment ankyrin repeat-containing protein C20orf12 [Homo sapiens]
Sequence
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGY
GENNTFKYIKPITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVL
KDSSRQEFKNGFVGSKLKKKYKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQS
QSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGC
RLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNP
AHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEASFCGWCGAML
GIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYW
RRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLY
LNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKE
QLIPENRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVL
VQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNT
GDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC
Download sequence
Identical sequences Q9NVP4
NP_001092877.1.87134 NP_001092877.1.92137 ENSP00000351734 NYSGRC-150378537 ENSP00000262547 ENSP00000351734 gi|150378537|ref|NP_001092877.1| 9606.ENSP00000262547 ENSP00000262547 ENSP00000351734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]