SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150456460|ref|NP_001092909.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150456460|ref|NP_001092909.1|
Domain Number 1 Region: 35-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-68
Family Ephrin receptor ligand binding domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 637-930
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.49e-66
Family Protein kinases, catalytic subunit 0.0000000474
Further Details:      
 
Domain Number 3 Region: 337-534
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-26
Family Fibronectin type III 0.00045
Further Details:      
 
Domain Number 4 Region: 932-1003
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.24e-16
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|150456460|ref|NP_001092909.1|
Domain Number - Region: 266-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000759
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150456460|ref|NP_001092909.1|
Sequence length 1008
Comment ephrin type-A receptor 10 isoform 3 [Homo sapiens]
Sequence
METCAGPHPLRLFLCRMQLCLALLLGPWRPGTAEEVILLDSKASQAELGWTALPSNGWEE
ISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAG
TCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREI
GPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLATFPATAAESAFSTLVEVAGTC
VAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDFCEACPPGFYKVSPRRPLCS
PCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLVLRLRWL
PPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFLPRQAGLRERAATLLHLRPGAR
YTVRVAALNGVSGPAAAAGTTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPA
GAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEA
QSFNPSIEVQTLGEAASGSRDQSPAIVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGG
DAHDEEELYFHFKVPTRRTFLDPQSCGDLLQAVHLFAKELDAKSVTLERSLGGGRFGELC
CGCLQLPGRQELLVAVHMLRDSASDSQRLGFLAEALTLGQFDHSHIVRLEGVVTRGSTLM
IVTEYMSHGALDGFLRRHEGQLVAGQLMGLLPGLASAMKYLSEMGYVHRGLAARHVLVSS
DLVCKISGFGRGPRDRSEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGIIMWEVM
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPNLLHRLMLDCWQKDPGERPRFSQIHSIL
SKMVQDPEPPKCALTTCPRPPTPLADRAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYG
SLEAVAEMTAQDLVSLGISLAEHREALLSGISALQARVLQLQGQGVQV
Download sequence
Identical sequences Q5JZY3
ENSP00000362139 NP_001092909.1.87134 NP_001092909.1.92137 gi|150456460|ref|NP_001092909.1| ENSP00000362139 9606.ENSP00000362139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]