SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|151108435|ref|NP_689946.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|151108435|ref|NP_689946.2|
Domain Number 1 Region: 373-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000645
Family Galactose-binding domain 0.08
Further Details:      
 
Domain Number 2 Region: 241-330
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000652
Family Galactose-binding domain 0.045
Further Details:      
 
Domain Number 3 Region: 7-67
Classification Level Classification E-value
Superfamily POZ domain 0.0000000137
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|151108435|ref|NP_689946.2|
Sequence length 544
Comment BTB/POZ domain-containing protein 9 isoform b [Homo sapiens]
Sequence
MRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDS
TSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLSLSKTALLN
IVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPD
AILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG
FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQ
YLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVA
TIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLL
WDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEV
FHCVHFECPEQQSSQKEENSEESGTGDTSLAGQQLDSHALRAPSGSSLPSSPGSNSRSPN
RQHQ
Download sequence
Identical sequences A0A2J8NZE8 A0A2J8Y3V1
ENSP00000323408 ENSP00000386211 NP_689946.2.87134 NP_689946.2.92137 ENSP00000323408 gi|151108435|ref|NP_689946.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]