SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153082752|ref|NP_002190.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153082752|ref|NP_002190.2|
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.08e-46
Family Interferon regulatory factor 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153082752|ref|NP_002190.2|
Sequence length 349
Comment interferon regulatory factor 2 [Homo sapiens]
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Download sequence
Identical sequences G3RK92 P14316
ENSP00000377218 9606.ENSP00000377218 gi|153082752|ref|NP_002190.2| ENSP00000377218 ENSGGOP00000016154 NP_002190.2.87134 NP_002190.2.92137 XP_004040729.1.27298 ENSP00000377218 ENSGGOP00000016154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]