SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153792284|ref|NP_778146.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153792284|ref|NP_778146.2|
Domain Number 1 Region: 128-360
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.7e-60
Family Ankyrin repeat 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153792284|ref|NP_778146.2|
Sequence length 584
Comment POTE ankyrin domain family member D [Homo sapiens]
Sequence
MVAEVCSMPTASTVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKMLRSK
MGKCCRHCFPCCRGSGTSNVGTSGDHENSFMKMLRSKMGKWCCHCFPCCRGSGKSNVGAW
GDYDHSAFMEPRYHIRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKEKRTALHLA
SANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAIQCQEDECVLMLLEHGADRNIPDEYGN
TALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNV
LDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQL
SEEQNTGISQDEILTNKQKQIEVAEQKMNSELSLSHKKEEDLLRENSVLQEEIAMLRLEL
DETKHQNQLRENKILEEIESVKEKTDKLLRAMQLNEEALTKTNI
Download sequence
Identical sequences Q86YR6
gi|153792284|ref|NP_778146.2| ENSP00000299443 NP_778146.2.87134 NP_778146.2.92137 ENSP00000299443 ENSP00000299443 9606.ENSP00000299443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]