SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154091028|ref|NP_001073999.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154091028|ref|NP_001073999.2|
Domain Number 1 Region: 271-362
Classification Level Classification E-value
Superfamily PX domain 2.22e-25
Family PX domain 0.00066
Further Details:      
 
Weak hits

Sequence:  gi|154091028|ref|NP_001073999.2|
Domain Number - Region: 119-154
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.034
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154091028|ref|NP_001073999.2|
Sequence length 428
Comment sorting nexin-29 [Homo sapiens]
Sequence
MHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLGSLENGTGPEDHVLPDPGLRYSVEASS
PGHGSPLSSLLPSASVPESMTISELRQATVAMMNRKDELEEENRSLRNLLDGEMEHSAAL
RQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWS
VDGEVTVAEQKPGEIAEELASSYERKLIEVAEMHGELIEFNERLHRALVAKEALVSQMRQ
ELIDLRGPVPGDLSQTSEDQSLSDFEISNRALINVWIPSVFLRGKAANAFHVYQVYIRIK
DDEWNIYRRYTEFRSLHHKLQNKYPQVRAYNFPPKKAIGNKDAKFVEERRKQLQNYLRSV
MNKVIQMVPEFAASPKKETLIQLMPFFVDITPPGEPVNSRPKAASRFPKLSRGQPRETRN
VEPQSGDL
Download sequence
Identical sequences ENSP00000306940 gi|154091028|ref|NP_001073999.2| 9606.ENSP00000306940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]