SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154091032|ref|NP_653191.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154091032|ref|NP_653191.2|
Domain Number 1 Region: 8-189
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.84e-36
Family Ankyrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154091032|ref|NP_653191.2|
Sequence length 191
Comment ankyrin repeat domain-containing protein 22 [Homo sapiens]
Sequence
MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLL
RRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRM
LLDAGVEVNATDCYGCTALHYACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKF
SQIELMLRKAL
Download sequence
Identical sequences G1RNL5 K7BBG6 Q5VYY1
9606.ENSP00000360998 ENSNLEP00000014829 ENSP00000360998 NP_653191.2.87134 NP_653191.2.92137 XP_003255230.1.23891 XP_507900.2.37143 ENSNLEP00000014829 ENSP00000360998 gi|154091032|ref|NP_653191.2| ENSP00000360998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]