SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154759283|ref|NP_055418.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|154759283|ref|NP_055418.2|
Domain Number - Region: 32-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154759283|ref|NP_055418.2|
Sequence length 465
Comment cerebellar degeneration-related protein 2-like [Homo sapiens]
Sequence
MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQV
QEIEYLTKQLDTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIE
RLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSS
LELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEAC
RLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQD
GVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQY
HALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK
Download sequence
Identical sequences A0A024R8R6 Q86X02
gi|154759283|ref|NP_055418.2| NP_055418.2.87134 NP_055418.2.92137 ENSP00000336587 9606.ENSP00000336587 ENSP00000336587 ENSP00000336587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]