SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15553099|ref|NP_219489.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15553099|ref|NP_219489.1|
Domain Number 1 Region: 129-243
Classification Level Classification E-value
Superfamily PX domain 3.92e-21
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 224-337
Classification Level Classification E-value
Superfamily TPR-like 0.0000000073
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15553099|ref|NP_219489.1|
Sequence length 373
Comment sorting nexin-21 isoform a [Homo sapiens]
Sequence
MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGT
LSFTSAEDDEDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWK
KSRNTLAPQRLLFEVTSANVVKDPPSKYVLYTLAVIGPGPPDCQPAQISRRYSDFERLHR
NLQRQFRGPMAAISFPRKRLRRNFTAETIARRSRAFEQFLGHLQAVPELRHAPDLQDFFV
LPELRRAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPG
EARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEARLQALQEAGLTPTPP
PSLKELLIKEVLD
Download sequence
Identical sequences Q969T3
ENSP00000418593 ENSP00000361619 gi|15553099|ref|NP_219489.1| ENSP00000418593 9606.ENSP00000418593 NP_219489.1.87134 NP_219489.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]