SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15553127|ref|NP_000180.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15553127|ref|NP_000180.2|
Domain Number 1 Region: 671-911
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.51e-86
Family Hexokinase 0.0000000038
Further Details:      
 
Domain Number 2 Region: 223-463
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.74e-86
Family Hexokinase 0.0000000136
Further Details:      
 
Domain Number 3 Region: 17-221
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.85e-81
Family Hexokinase 0.000000103
Further Details:      
 
Domain Number 4 Region: 454-669
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.26e-77
Family Hexokinase 0.000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15553127|ref|NP_000180.2|
Sequence length 917
Comment hexokinase-2 [Homo sapiens]
Sequence
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA
VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR
GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV
EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME
EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG
LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH
PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS
HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV
LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG
TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD
FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG
IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA
VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG
AALITAVACRIREAGQR
Download sequence
Identical sequences P52789
9606.ENSP00000290573 ENSP00000290573 NP_000180.2.87134 NP_000180.2.92137 ENSP00000290573 gi|15553127|ref|NP_000180.2| ENSP00000290573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]