SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15559207|ref|NP_254275.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15559207|ref|NP_254275.1|
Domain Number 1 Region: 14-268
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-86
Family Eukaryotic proteases 0.0000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15559207|ref|NP_254275.1|
Sequence length 269
Comment chymotrypsin-like elastase family member 2A preproprotein [Homo sapiens]
Sequence
MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGG
SLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLV
VDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSR
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Download sequence
Identical sequences P08217
ENSP00000352639 ENSP00000352639 9606.ENSP00000352639 ENSP00000352639 gi|15559207|ref|NP_254275.1| NP_254275.1.87134 NP_254275.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]