SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156104878|ref|NP_055720.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156104878|ref|NP_055720.3|
Domain Number 1 Region: 223-531
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.67e-118
Family Glutaminase 0.0000044
Further Details:      
 
Domain Number 2 Region: 557-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-16
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156104878|ref|NP_055720.3|
Sequence length 669
Comment glutaminase kidney isoform, mitochondrial precursor [Homo sapiens]
Sequence
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
Download sequence
Identical sequences G3SB67 H2QJ59 O94925
ENSP00000317379 NP_055720.3.87134 NP_055720.3.92137 XP_001167502.1.37143 XP_018877550.1.27298 gi|156104878|ref|NP_055720.3| ENSPTRP00000021790 ENSP00000317379 ENSPTRP00000021790 9598.ENSPTRP00000021790 9606.ENSP00000317379 ENSP00000317379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]