SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156104901|ref|NP_115626.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156104901|ref|NP_115626.2|
Domain Number 1 Region: 34-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.76e-56
Family Ankyrin repeat 0.00029
Further Details:      
 
Weak hits

Sequence:  gi|156104901|ref|NP_115626.2|
Domain Number - Region: 650-751
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156104901|ref|NP_115626.2|
Sequence length 823
Comment ankyrin repeat domain-containing protein 20A1 [Homo sapiens]
Sequence
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGDL
DALDKQHRTALHLACTSGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEK
MVEFLLKKKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAI
SHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLNVATKQC
VPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAVQRKNVQTLRA
EQALPVASEEEQERHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
IGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLE
PTVQSLEMKSKTARNTPNWDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKEN
KYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKK
RLEADIESYQSRLAAAISKHSESVKTERNLKLALERTRDVSVQVEMSSAISKVKAENEFL
TEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLSQTQQQTQEMKEMYQNAEAKV
NNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDLVLEE
KSKKLMNECDHLKESLFQYEREKTEGVVSIKEDKYFQTSRKTI
Download sequence
Identical sequences Q5TYW2
9606.ENSP00000366697 ENSP00000366697 NP_115626.2.87134 NP_115626.2.92137 gi|156104901|ref|NP_115626.2| HR5360 ENSP00000366697 ENSP00000477695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]