SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156139139|ref|NP_079231.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156139139|ref|NP_079231.4|
Domain Number 1 Region: 29-249
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-29
Family FAD-linked reductases, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156139139|ref|NP_079231.4|
Sequence length 684
Comment FAD-dependent oxidoreductase domain-containing protein 2 precursor [Homo sapiens]
Sequence
MGLSAAAPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFE
RAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFP
DARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLFV
ATGLSVPNQVDFPGSEYAEGYESVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIH
MLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAILKDSKGKFHVTP
KFFLEEANTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNKSLRLNSGNAF
GKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSV
TWPATELPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQL
ETLTGRKAKHGLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRYLP
TEQEVRFRPAHWPLPRPTAIHHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAES
CFLFALTRQKLPPFCQQGYLRMQGLVSTESLWQHRVESRLLRDYAPTGRRLEDSSQQLGD
QEPLGSPLAPGPLAQSVDSNKEEL
Download sequence
Identical sequences Q8IWF2
gi|156139139|ref|NP_079231.4| gi|156139141|ref|NP_001095841.1| 9606.ENSP00000216187 NP_001095841.1.87134 NP_001095841.1.92137 NP_079231.4.87134 NP_079231.4.92137 ENSP00000216187 ENSP00000380400 ENSP00000380401 ENSP00000216187 ENSP00000216187 ENSP00000380400 ENSP00000380401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]