SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156142184|ref|NP_057550.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156142184|ref|NP_057550.3|
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-37
Family Ankyrin repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156142184|ref|NP_057550.3|
Sequence length 183
Comment ankyrin repeat domain-containing protein 39 [Homo sapiens]
Sequence
MATPRPCADGPCCSHPSAVLGVQQTLEEMDFERGIWSAALNGDLGRVKHLIQKAEDPSQP
DSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHG
SNPRVVDDDGMTSLHKAAERGHGDICSLLLQHSPALKAIRDRKARLACDLLPCNSDLRDL
LSS
Download sequence
Identical sequences H2QID6 Q53RE8
ENSPTRP00000020986 ENSP00000377170 ENSP00000398321 NP_057550.3.87134 NP_057550.3.92137 XP_515633.3.37143 gi|156142184|ref|NP_057550.3| ENSP00000377170 ENSP00000377170 ENSP00000398321 ENSPTRP00000020986 9598.ENSPTRP00000020986 9606.ENSP00000377170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]