SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156151392|ref|NP_001095867.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156151392|ref|NP_001095867.1|
Domain Number 1 Region: 232-333
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.34e-23
Family Canonical RBD 0.00038
Further Details:      
 
Domain Number 2 Region: 42-140
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-20
Family Canonical RBD 0.0037
Further Details:      
 
Domain Number 3 Region: 146-232
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.11e-18
Family Canonical RBD 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|156151392|ref|NP_001095867.1|
Sequence length 532
Comment heterogeneous nuclear ribonucleoprotein R isoform 4 [Homo sapiens]
Sequence
MKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQP
GIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQE
AVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQ
PDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVK
VLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEG
EEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYP
PDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAP
PPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQP
DSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK
Download sequence
Identical sequences F7GDH1
gi|156151392|ref|NP_001095867.1| NP_001095867.1.87134 NP_001095867.1.92137 XP_003271636.1.23891 XP_003307911.1.37143 XP_004024924.1.27298 XP_004394830.1.74151 XP_005203174.1.76553 XP_005544541.1.63531 XP_006056619.1.26621 XP_009448755.1.37143 XP_010354077.1.97406 XP_010828329.1.44457 XP_010955684.1.22495 XP_011800947.1.43180 XP_011833205.1.47321 XP_011935588.1.92194 XP_011970806.1.54773 XP_012903301.1.14098 XP_014986098.1.72884 XP_017911039.1.57651 XP_019837228.1.53367 XP_020730176.1.74333 XP_021539791.1.83697 XP_535365.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]