SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157266328|ref|NP_000456.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157266328|ref|NP_000456.2|
Domain Number 1 Region: 26-122
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-49
Family RING finger domain, C3HC4 0.00000165
Further Details:      
 
Domain Number 2 Region: 423-533
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-36
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 569-669
Classification Level Classification E-value
Superfamily BRCT domain 3.63e-21
Family BRCT domain 0.016
Further Details:      
 
Domain Number 4 Region: 616-776
Classification Level Classification E-value
Superfamily BRCT domain 6.15e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157266328|ref|NP_000456.2|
Sequence length 777
Comment BRCA1-associated RING domain protein 1 [Homo sapiens]
Sequence
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP
VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL
SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY
EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV
SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP
EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP
ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM
AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL
LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK
SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF
DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS
RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV
AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS
Download sequence
Identical sequences Q99728
gi|157266328|ref|NP_000456.2| 9606.ENSP00000260947 NP_000456.2.87134 NP_000456.2.92137 ENSP00000260947 ENSP00000260947 ENSP00000260947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]