SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157388995|ref|NP_060727.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157388995|ref|NP_060727.2|
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.53e-24
Family Protein-L-isoaspartyl O-methyltransferase 0.003
Further Details:      
 
Weak hits

Sequence:  gi|157388995|ref|NP_060727.2|
Domain Number - Region: 341-359
Classification Level Classification E-value
Superfamily SOCS box-like 0.0876
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157388995|ref|NP_060727.2|
Sequence length 361
Comment protein-L-isoaspartate O-methyltransferase domain-containing protein 2 isoform 1 [Homo sapiens]
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEY
AKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPVAV
RSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFAS
RISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYRE
K
Download sequence
Identical sequences A0A2I3SHL6 Q5R7K4 Q9NV79
ENSP00000307854 ENSP00000482166 ENSP00000266078 ENSPTRP00000023735 ENSPPYP00000012583 gi|157388995|ref|NP_060727.2| NP_001126320.1.23681 NP_060727.2.87134 NP_060727.2.92137 XP_003317121.1.37143 XP_008960565.1.60992 XP_008960566.1.60992 XP_008960567.1.60992 XP_009435974.1.37143 XP_009435976.1.37143 XP_009435977.1.37143 9598.ENSPTRP00000023735 9600.ENSPPYP00000012583 9606.ENSP00000307854 HR5981 ENSPTRP00000023735 ENSP00000307854 ENSPPYP00000012583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]