SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157738609|ref|NP_078878.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157738609|ref|NP_078878.3|
Domain Number 1 Region: 523-849
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 5.23e-74
Family Hect, E3 ligase catalytic domain 0.00019
Further Details:      
 
Domain Number 2 Region: 172-370
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-41
Family APC10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157738609|ref|NP_078878.3|
Sequence length 861
Comment E3 ubiquitin-protein ligase HECTD3 [Homo sapiens]
Sequence
MAGPGPGAVLESPRQLLGRVRFLAEAARSLRAGRPLPAALAFVPREVLYKLYKDPAGPSR
VLLPVWEAEGLGLRVGAAGPAPGTGSGPLRAARDSIELRRGACVRTTGEELCNGHGLWVK
LTKEQLAEHLGDCGLQEGWLLVCRPAEGGARLVPIDTPNHLQRQQQLFGVDYRPVLRWEQ
VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSV
KQYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDT
TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDG
IDVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
VLHHLVPAWDHTLGTFSEIKQVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRL
AMEHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQ
GGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEW
IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF
EFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQA
GLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNF
TNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
KLRYAAYNCVAIDTDMSPWEE
Download sequence
Identical sequences G3QGP7 Q5T447
gi|157738609|ref|NP_078878.3| ENSGGOP00000001508 ENSGGOP00000001508 9606.ENSP00000361245 ENSP00000361245 NYSGRC-157738609 NP_078878.3.87134 NP_078878.3.92137 XP_004025725.1.27298 ENSP00000361245 ENSP00000361241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]