SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157743292|ref|NP_997721.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157743292|ref|NP_997721.2|
Domain Number 1 Region: 68-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.62e-48
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 419-461
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157743292|ref|NP_997721.2|
Sequence length 466
Comment ankyrin repeat and SOCS box protein 18 [Homo sapiens]
Sequence
MSNSDYLPDYPLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSA
QLPTGMLLGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKREL
TTPLCIAAAHGHTACVRHLLGRGADPDASPGGRGALHEACLGGHTACVRLLLQHRADPDL
LSAEGLAPLHLCRTAASLGCAQALLEHGASVQRVGGTGRDTPLHVAAQRGLDEHARLYLG
RGAHVDARNGRGETALSAACGAARRPDEHGRCLRLCALLLRRGAEADARDEDERSPLHKA
CGHASHSLARLLLRHGADAGALDYGGASPLGRVLQTASCALQASPQRTVQALLNHGSPTV
WPDAFPKVLKTCASVPAVIEVLFNSYPQLCLSESWKEVIPEEVFQMHKPFYQSLFALALT
PRCLQHLCRCALRRLFGKRCFDLIPLLPLPKPLQNYLLLEPQGVLH
Download sequence
Identical sequences Q6ZVZ8
NP_997721.2.87134 NP_997721.2.92137 gi|157743292|ref|NP_997721.2| ENSP00000386532 ENSP00000329970 9606.ENSP00000386532 ENSP00000386532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]