SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15812198|ref|NP_036300.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15812198|ref|NP_036300.2|
Domain Number 1 Region: 110-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-75
Family F-box associated region, FBA 0.0000000162
Further Details:      
 
Domain Number 2 Region: 45-140
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000314
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15812198|ref|NP_036300.2|
Sequence length 296
Comment F-box only protein 2 [Homo sapiens]
Sequence
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLA
ALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRR
RNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQ
VIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVA
VPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences Q9UK22
ENSP00000346240 NP_036300.2.87134 NP_036300.2.92137 9606.ENSP00000346240 gi|15812198|ref|NP_036300.2| ENSP00000346240 ENSP00000346240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]