SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15826852|ref|NP_073572.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15826852|ref|NP_073572.2|
Domain Number 1 Region: 390-444,475-527
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 6.8e-31
Family Supernatant protein factor (SPF), C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 83-170
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 6.15e-19
Family Acyl-CoA binding protein 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15826852|ref|NP_073572.2|
Sequence length 528
Comment Golgi resident protein GCP60 [Homo sapiens]
Sequence
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEP
GEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL
MGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHK
IEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLE
QQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALEN
GPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEF
ATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIV
PVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR
Download sequence
Identical sequences A0A024R3P9 Q9H3P7
9606.ENSP00000355777 ENSP00000355777 gi|15826852|ref|NP_073572.2| ENSP00000355777 ENSP00000355777 NP_073572.2.87134 NP_073572.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]