SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15967161|ref|NP_277043.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15967161|ref|NP_277043.1|
Domain Number 1 Region: 218-458
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.66e-82
Family Hexokinase 0.00000000058
Further Details:      
 
Domain Number 2 Region: 11-216
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.59e-76
Family Hexokinase 0.00000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15967161|ref|NP_277043.1|
Sequence length 464
Comment glucokinase isoform 3 [Homo sapiens]
Sequence
MPRPRSQLPQPNSQVEQILAEFQLQEEDLKKVMRRMQKEMDRGLRLETHEEASVKMLPTY
VRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEM
LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNV
VGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHQCEVGMIVGTGCNACYMEEMQNV
ELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRLVDESSANPGQQLYEKLIGGKYMGEL
VRLVLLRLVDENLLFHGEASEQLRTRGAFETRFVSQVESDTGDRKQIYNILSTLGLRPST
TDCDIVRRACESVSTRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFKE
RFHASVRRLTPSCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Download sequence
Identical sequences A0A2J8L9J1
NP_277043.1.87134 NP_277043.1.92137 gi|15967161|ref|NP_277043.1| ENSP00000379142 ENSP00000379142 ENSP00000482149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]