SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15991827|ref|NP_277031.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15991827|ref|NP_277031.1|
Domain Number 1 Region: 671-910
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.2e-86
Family Hexokinase 0.000000000628
Further Details:      
 
Domain Number 2 Region: 222-462
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.3e-85
Family Hexokinase 0.000000000714
Further Details:      
 
Domain Number 3 Region: 453-667
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.87e-80
Family Hexokinase 0.00000000505
Further Details:      
 
Domain Number 4 Region: 21-220
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.78e-75
Family Hexokinase 0.00000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15991827|ref|NP_277031.1|
Sequence length 916
Comment hexokinase-1 isoform HKI-R [Homo sapiens]
Sequence
MDCEHSLSLPCRGAEAWEIGIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATV
KMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHG
SGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVE
GADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEE
LRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMY
LGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGV
EPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHP
QYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTK
DMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVL
LVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFT
FSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGT
MMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDI
RTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGI
FETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAV
VDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGA
ALITAVGVRLRTEASS
Download sequence
Identical sequences ENSP00000298649 ENSP00000298649 NP_277031.1.87134 NP_277031.1.92137 gi|15991827|ref|NP_277031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]