SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15991829|ref|NP_277032.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15991829|ref|NP_277032.1|
Domain Number 1 Region: 676-915
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.2e-86
Family Hexokinase 0.000000000628
Further Details:      
 
Domain Number 2 Region: 227-467
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.45e-85
Family Hexokinase 0.000000000714
Further Details:      
 
Domain Number 3 Region: 458-672
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.94e-80
Family Hexokinase 0.00000000505
Further Details:      
 
Domain Number 4 Region: 25-225
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.29e-76
Family Hexokinase 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15991829|ref|NP_277032.1|
Sequence length 921
Comment hexokinase-1 isoform HKI-ta/tb [Homo sapiens]
Sequence
MGQICQRESATAAEKPKLHLLAESEIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNG
CLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
Download sequence
Identical sequences A0A024QZK7
ENSP00000384774 ENSP00000402103 9606.ENSP00000348697 gi|15991829|ref|NP_277032.1| gi|15991831|ref|NP_277033.1| NP_001309293.1.87134 NP_001309293.1.92137 NP_277032.1.87134 NP_277032.1.92137 NP_277033.1.87134 NP_277033.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]