SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16418439|ref|NP_443182.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16418439|ref|NP_443182.1|
Domain Number 1 Region: 13-272
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-38
Family WD40-repeat 0.0057
Further Details:      
 
Domain Number 2 Region: 283-372
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.46e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|16418439|ref|NP_443182.1|
Domain Number - Region: 361-395
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0565
Family Quinoprotein alcohol dehydrogenase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16418439|ref|NP_443182.1|
Sequence length 400
Comment WD repeat and FYVE domain-containing protein 2 [Homo sapiens]
Sequence
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYW
PSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMI
LFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVT
ILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQG
HNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQ
MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTA
TFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Download sequence
Identical sequences Q96P53
ENSP00000298125 NP_443182.1.87134 NP_443182.1.92137 NYSGRC-16418439 9606.ENSP00000298125 ENSP00000298125 gi|16418439|ref|NP_443182.1| ENSP00000298125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]