SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16507237|ref|NP_005338.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16507237|ref|NP_005338.1|
Domain Number 1 Region: 28-213
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.59e-71
Family Actin/HSP70 0.000000218
Further Details:      
 
Domain Number 2 Region: 215-407
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.28e-68
Family Actin/HSP70 0.000000468
Further Details:      
 
Domain Number 3 Region: 410-566
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.12e-64
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000797
Further Details:      
 
Domain Number 4 Region: 560-642
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 1.2e-26
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16507237|ref|NP_005338.1|
Sequence length 654
Comment 78 kDa glucose-regulated protein precursor [Homo sapiens]
Sequence
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
Download sequence
Identical sequences A0A0D9RMF3 A0A2K5K351 A0A2K5P3X2 A0A2K5WXY8 A0A2K5Z4X7 A0A2K6B1A7 A0A2K6NWE4 F7C3R1 G3S6H1 H2PTE3 H2PYQ3 P11021 V9HWB4
NP_001253525.1.72884 NP_005338.1.87134 NP_005338.1.92137 XP_003808092.1.60992 XP_004048650.1.27298 XP_005582274.1.63531 XP_008004447.1.81039 XP_010364166.1.97406 XP_011709649.1.29376 XP_011786773.1.43180 XP_011844077.1.47321 XP_011894552.1.92194 XP_520257.2.37143 ENSPTRP00000000984 ENSMMUP00000006906 ENSPPYP00000021973 ENSPTRP00000000984 ENSMMUP00000006906 ENSP00000324173 Hs16507237___KOG0100 gi|16507237|ref|NP_005338.1| ENSP00000324173 9544.ENSMMUP00000006906 9598.ENSPTRP00000000984 9600.ENSPPYP00000021973 9606.ENSP00000324173 ENSPPYP00000021973 ENSP00000324173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]