SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166235148|ref|NP_036515.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166235148|ref|NP_036515.4|
Domain Number 1 Region: 71-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-28
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-23
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166235148|ref|NP_036515.4|
Sequence length 214
Comment osteoclast-stimulating factor 1 [Homo sapiens]
Sequence
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEMLFTQPNIELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMA
TNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD
Download sequence
Identical sequences A0A2I3SS18 A0A2J8SU83 G3R8D0 Q92882
ENSPTRP00000035955 ENSGGOP00000011634 ENSPTRP00000035955 ENSP00000340836 9600.ENSPPYP00000021620 9606.ENSP00000340836 gi|166235148|ref|NP_036515.4| ENSGGOP00000011634 NP_036515.4.87134 NP_036515.4.92137 XP_004048190.1.27298 XP_009242801.1.23681 XP_520078.2.37143 ENSP00000340836 ENSP00000340836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]