SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167466286|ref|NP_694966.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|167466286|ref|NP_694966.3|
Domain Number - Region: 20-102
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00147
Family Double-stranded RNA-binding domain (dsRBD) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167466286|ref|NP_694966.3|
Sequence length 282
Comment protein limb expression 1 homolog [Homo sapiens]
Sequence
MDRTLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLP
APGPPFVSYVTLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMES
VQEAVASTSGTLDDADDPSTSVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALR
ETKCSRQEVISYYSQYSLDEKMRSHMALDWIMKERDSPGIVSQELRMALRQLEEARKAGQ
ELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCGYH
Download sequence
Identical sequences Q8N485
ENSP00000274382 NP_694966.3.87134 NP_694966.3.92137 gi|167466286|ref|NP_694966.3| ENSP00000274382 ENSP00000274382 9606.ENSP00000274382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]