SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167830477|ref|NP_001108086.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167830477|ref|NP_001108086.1|
Domain Number 1 Region: 68-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000673
Further Details:      
 
Domain Number 2 Region: 229-335
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00017
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167830477|ref|NP_001108086.1|
Sequence length 335
Comment lactadherin isoform b [Homo sapiens]
Sequence
MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKG
YAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHK
EFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHS
HKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Download sequence
Identical sequences X6R3G6
ENSP00000268151 ENSP00000268151 NP_001108086.1.87134 NP_001108086.1.92137 gi|167830477|ref|NP_001108086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]