SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|168229256|ref|NP_689576.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|168229256|ref|NP_689576.4|
Domain Number 1 Region: 14-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-23
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 2 Region: 353-402
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000294
Family LEM domain 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|168229256|ref|NP_689576.4|
Domain Number - Region: 224-283
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.000971
Family AglA-like glucosidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|168229256|ref|NP_689576.4|
Sequence length 615
Comment ankyrin repeat and LEM domain-containing protein 1 [Homo sapiens]
Sequence
MCSEARLARRLRDALREEEPWAVEELLRCGADPNLVLEDGAAAVHLAAGARHPRGLRCLG
ALLRQGGDPNARSVEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPLDLALQQG
HLECARVLQDLDTRTRTRTRIGAETQEPEPAPGTPGLSGPTDETLDSIALQKQPCRGDNR
DIGLEADPGPPSLPVPLETVDKHGSSASPPGHWDYSSDASFVTAVEVSGAEDPASDTPPW
AGSLPPTRQGLLHVVHANQRVPRSQGTEAELNARLQALTLTPPNAAGFQSSPSSMPLLDR
SPAHSPPRTPTPGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGREPVGPCRHLPVST
VSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIP
DVQADEDALAQQFEQPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTF
IRAIFYVGKGTRARPYVHLWEALGHHGRSRKQPHQACPKVRQILDIWASGCGVVSLHCFQ
HVVAVEAYTREACIVEALGIQTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLA
EGERQLHPQDIQARG
Download sequence
Identical sequences Q8NAG6
9606.ENSP00000384753 ENSP00000377971 gi|168229256|ref|NP_689576.4| ENSP00000377971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]