SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169403957|ref|NP_079209.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169403957|ref|NP_079209.3|
Domain Number 1 Region: 140-275
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-38
Family Ankyrin repeat 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169403957|ref|NP_079209.3|
Sequence length 343
Comment ankyrin repeat domain-containing protein 53 isoform b [Homo sapiens]
Sequence
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALARPRRPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QGQGCSVHFPFAFSPITPETLLWQDISLLSDCGFLWRRRELSF
Download sequence
Identical sequences NP_079209.3.87134 NP_079209.3.92137 gi|169403957|ref|NP_079209.3| ENSP00000272421 ENSP00000272421 ENSP00000475412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]