SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169636415|ref|NP_000056.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169636415|ref|NP_000056.2|
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000675
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000012
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000607
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169636415|ref|NP_000056.2|
Sequence length 934
Comment complement component C6 precursor [Homo sapiens]
Sequence
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
Download sequence
Identical sequences P13671
ENSP00000263413 ENSP00000338861 NP_000056.2.87134 NP_000056.2.92137 NP_001108603.2.87134 NP_001108603.2.92137 ENSP00000263413 ENSP00000263413 ENSP00000338861 9606.ENSP00000263413 gi|169636415|ref|NP_000056.2| gi|189242612|ref|NP_001108603.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]